Fbxl2 (NM_178624) Mouse Recombinant Protein

CAT#: TP506738

Purified recombinant protein of Mouse F-box and leucine-rich repeat protein 2 (Fbxl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206738 protein sequence
Red=Cloning site Green=Tags(s)

MVFSNSDDGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDLFNFQTDVEGRVVE
NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC
VSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHEL
VSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTL
LARNCHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDN
CLLVTDASLEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPPAVAGSGHRLCRCC
VIL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_848739
Locus ID 72179
UniProt ID Q8BH16
Refseq Size 3203
Cytogenetics 9 F3
Refseq ORF 1272
Synonyms 2810423A21Rik; Fbl3
Summary Calcium-activated substrate recognition component of the SCF (SKP1-cullin-F-box protein) E3 ubiquitin-protein ligase complex, SCF(FBXL2), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Unlike many F-box proteins, FBXL2 does not seem to target phosphodegron within its substrates but rather calmodulin-binding motifs and is thereby antagonized by calmodulin. This is the case for the cyclins CCND2 and CCND3 which polyubiquitination and subsequent degradation are inhibited by calmodulin. Through CCND2 and CCND3 degradation induces cell-cycle arrest in G(0). SCF(FBXL2) also mediates PIK3R2 ubiquitination and proteasomal degradation thereby regulating phosphatidylinositol 3-kinase signaling and autophagy (By similarity). PCYT1A monoubiquitination by SCF(FBXL2) and subsequent degradation regulates synthesis of phosphatidylcholine, which is utilized for formation of membranes and of pulmonary surfactant (PubMed:21343341).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...