Esrp1 (NM_194055) Mouse Recombinant Protein

CAT#: TP507090

Purified recombinant protein of Mouse epithelial splicing regulatory protein 1 (Esrp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Mouse monoclonal Esrp-1 antibody
    • 100 ug

CNY 8,303.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207090 protein sequence
Red=Cloning site Green=Tags(s)

MTESLNFEKSDSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERLNYKFESGTCSKMELIDDSTVVRAR
GLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHMGTRYIEVYKA
TGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHCPITGGKEGILFVTYPDGRPT
GDAFVLFACEEYAQNALRKHKELLGKRYIELFRSTAAEVQQVLNRFSSAPLIPLPTPPIIPVLPQQFVPP
TNVRDCIRLRGLPYAATIEDILDFLGEFSTDIRTHGVHMVLNHQGRPSGDAFIQMKSTDRAFMAAQKYHK
KTMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSPPPCLSPPSYTFPAPTAVIPTEAAIYQPSLLLNPRAL
QPSTAYYPAGTQLFMNYTAYYPSV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 49.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_918944
Locus ID 207920
UniProt ID Q3US41
Refseq Size 3969
Cytogenetics 4 A1
Refseq ORF 1335
Synonyms 2210008M09Rik; A630065D16; BC031468; Rbm35a
Summary mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Also regulates the splicing of CD44, CTNND1, ENAH, 3 transcripts that undergo changes in splicing during the epithelial-to-mesenchymal transition (EMT). Acts by directly binding specific sequences in mRNAs. Binds the GU-rich sequence motifs in the ISE/ISS-3, a cis-element regulatory region present in the mRNA of FGFR2 (By similarity). Regulates splicing and expression of genes involved in inner ear development, auditory hair cell differentiation, and cell fate specification in the cochlear epithelium (PubMed:29107558).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...