F7 (NM_010172) Mouse Recombinant Protein
CAT#: TP507115
Purified recombinant protein of Mouse coagulation factor VII (F7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR207115 protein sequence
Red=Cloning site Green=Tags(s) MVPQAHGLLLLCFLLQLQGPLGTAVFITQEEAHGVLHRQRRANSLLEELWPGSLERECNEEQCSFEEARE IFKSPERTKQFWIVYSDGDQCASNPCQNGGTCQDHLKSYVCFCLLDFEGRNCEKSKNEQLICANENGDCD QYCRDHVGTKRTCSCHEDYTLQPDEVSCKPKVEYPCGRIPVVEKRNSSSRQGRIVGGNVCPKGECPWQAV LKINGLLLCGAVLLDARWIVTAAHCFDNIRYWGNITVVMGEHDFSEKDGDEQVRRVTQVIMPDKYIRGKI NHDIALLRLHRPVTFTDYVVPLCLPEKSFSENTLARIRFSRVSGWGQLLDRGATALELMSIEVPRLMTQD CLEHAKHSSNTPKITENMFCAGYMDGTKDACKGDSGGPHATHYHGTWYLTGVVSWGEGCAAIGHIGVYTR VSQYIDWLVRHMDSKLQVGVFRLPLL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 50.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034302 |
Locus ID | 14068 |
UniProt ID | P70375 |
Refseq Size | 1868 |
Cytogenetics | 8 5.73 cM |
Refseq ORF | 1341 |
Synonyms | AI132620; Cf7; F; FVII |
Summary | This gene encodes a vitamin K-dependent serine protease that plays a critical role in the extrinsic pathway of blood coagulation. Upon contact with tissue factor III (TF III), the encoded protein forms an activated complex termed TF-FVIIa that initiates the coagulation cascade involving other coagulation factors, ultimately resulting in a fibrin clot. Complete lack of the encoded protein in mice results in in perinatal lethality due to bleeding from normal blood vessels. [provided by RefSeq, Apr 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402739 | F7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402739 | Transient overexpression lysate of coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2 |
CNY 4,840.00 |
|
PH313143 | F7 MS Standard C13 and N15-labeled recombinant protein (NP_062562) |
CNY 19,520.00 |
|
TP313143 | Recombinant protein of human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP701041 | Purified recombinant protein of Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |