Atg4c (NM_001145967) Mouse Recombinant Protein
CAT#: TP507307
Purified recombinant protein of Mouse autophagy related 4C, cysteine peptidase (Atg4c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR207307 protein sequence
Red=Cloning site Green=Tags(s) MEASGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDESKMLPARSGCAIEDH VIAGNVEEFRKDFISRLWLTYREEFPQIEASALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALH IENADSDSWTSNTVKKFTASFEASLSGDRELRTPAVSLKETSGKCPDDHAVRNEAYHRKIISWFGDSPVA VFGLHRLIEFGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGLTIYVAQDCTVYNSDVIDKQTDSVT AGDARDKAVIILVPVRLGGERTNTDYLEFVKGVLSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQ SFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFERASEEITKMLKISSKEKYPLFTFVN GHSKDFDFTSTAASEEDLFSEDERKNFKRFSTEEFVLL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 52.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001139439 |
Locus ID | 242557 |
UniProt ID | Q811C2, Q3UYA5 |
Refseq Size | 2854 |
Cytogenetics | 4 C6 |
Refseq ORF | 1377 |
Synonyms | Apg4-C; Apg4c; Atg4cl; Autl1 |
Summary | Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins MAP1LC3 and GABARAPL2, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Has also an activity of delipidating enzyme for the PE-conjugated forms (By similarity). Is not essential for autophagy development under normal conditions but is required for a proper autophagic response under stressful conditions such as prolonged starvation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |