Msl3 (NM_010832) Mouse Recombinant Protein

CAT#: TP507442

Purified recombinant protein of Mouse MSL complex subunit 3 (Msl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
MSL3 Antibody - middle region
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207442 protein sequence
Red=Cloning site Green=Tags(s)

MPSWDRWAAEEHVLHDTDENRRLQRKLAKKAIARLRGTGKKKRRCRLPGVDSVLKSVPVKEKSKNDENSV
SSTCHESCGEKNGGIKEHRQRRIKVKAKAKKKVLSLRSRKEMDERTITIDIPDVLKKQLEDDCYYINRRK
RLVKLPCQTNIITILESYVKHFAINAAFSANERPRHHHAMMHTHMNVHYVPAEKNVDLCKEMVDGLRITF
DYTLPLVLLYPYEQTQYKRVTSSKFFLPIKESTTTTNRSQEELSPSPPLLNPSTPQSTESQPPTGEPATP
KRRKAEPEALQSLRRSTRHSTNCDRLSESSSSPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLT
PSKDGSAVFAGFEGRRPNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEK
NLKALLKHFDLFLRFLAEYHDDFFPESAYVAACEAHYSTKNPRAIY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034962
Locus ID 17692
UniProt ID Q9WVG9
Refseq Size 3338
Cytogenetics X F5
Refseq ORF 1401
Synonyms AU018931; Msl3l1; Msl31
Summary Has a role in chromatin remodeling and transcriptional regulation. Has a role in X inactivation. Component of the MSL complex which is responsible for the majority of histone H4 acetylation at 'Lys-16' which is implicated in the formation of higher-order chromatin structure. Specifically recognizes histone H4 monomethylated at 'Lys-20' (H4K20Me1) in a DNA-dependent manner and is proposed to be involved in chromosomal targeting of the MSL complex.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...