Pxylp1 (NM_153420) Mouse Recombinant Protein

CAT#: TP507698

Purified recombinant protein of Mouse 2-phosphoxylose phosphatase 1 (Pxylp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207698 protein sequence
Red=Cloning site Green=Tags(s)

MLHRNRFLVLLALAGLLAFLSLSLQFFHLIPVSATKNGGSSKSRKRIMPDPVTEPPTVDPVYEALLYCNI
PSVAEHSMEGHAPHHYKLVSVHVFIRHGDRYPLYAIPKTKRPEIDCTLVASRKPYHPKLEAFISHMLKGS
GASFESPLNSLPLYPNHPLCETGELTQTGVVQHLLNGQLLRDIYLRKHKLLPNNWSSDQLYLESTGKSRT
LQSGLALLYGFLPEFDWKKVYFKHQPSALFCSGSCYCPLRNQYLEKEQRRQYLLRLKNSDLERTYGEMAK
IVDIPTKQLRAANPIDSMLCHFCHNVSFPCSRSGCLGMEHFKVIKTHQIEDERERHEKLLYFGYSLLGAH
PILNQTVNRMQRAASGWRDELFTLYSAHDVTLSPILSALGLLEARFPRFAARLVFELWQDRQKPSEHSVR
ILYNGADVTFHTSFCHDFHKRSPKPMCPLENLVRFVKRDMFVALDGSSTNYYDACHGEGA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 54.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_700469
Locus ID 235534
UniProt ID Q8BHA9
Refseq Size 3172
Cytogenetics 9 E3.3
Refseq ORF 1443
Synonyms 9430094M07Rik; Acpl2; BB177120; C130099A20Rik
Summary Responsible for the 2-O-dephosphorylation of xylose in the glycosaminoglycan-protein linkage region of proteoglycans thereby regulating the amount of mature glycosaminoglycan (GAG) chains. Sulfated glycosaminoglycans (GAGs), including heparan sulfate and chondroitin sulfate, are synthesized on the so-called common GAG-protein linkage region (GlcUAbeta1-3Galbeta1-3Galbeta1-4Xylbeta1-O-Ser) of core proteins, which is formed by the stepwise addition of monosaccharide residues by the respective specific glycosyltransferases. Xylose 2-O-dephosphorylation during completion of linkage region formation is a prerequisite for the initiation and efficient elongation of the repeating disaccharide region of GAG chains.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...