Arih2 (NM_011790) Mouse Recombinant Protein

CAT#: TP507887

Purified recombinant protein of Mouse ariadne RBR E3 ubiquitin protein ligase 2 (Arih2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207887 protein sequence
Red=Cloning site Green=Tags(s)

MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEG
ALHEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYRSNSAQLLVEARVQPNPSKHVPTAHPPHHCAV
CMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGISCMAQDCPLRTPEDFVFPLLPNEELRDKYR
RYLFRDYVESHFQLQLCPGADCPMVIRVQEPRARRVQCNRCSEVFCFKCRQMYHAPTDCATIRKWLTKCA
DDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIVN
QSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYERIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKCR
YTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKDFH
DT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 57.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035920
Locus ID 23807
UniProt ID Q9Z1K6
Refseq Size 3924
Cytogenetics 9 F2
Refseq ORF 1479
Synonyms AI843547; ARI2; TRIAD1; UIP48
Summary E3 ubiquitin-protein ligase, which catalyzes ubiquitination of target proteins together with ubiquitin-conjugating enzyme E2 UBE2L3 (By similarity). Acts as an atypical E3 ubiquitin-protein ligase by working together with cullin-5-RING ubiquitin ligase complex (ECS complex, also named CRL5 complex) and initiating ubiquitination of ECS substrates: associates with ECS complex and specifically mediates addition of the first ubiquitin on ECS targets (By similarity). The initial ubiquitin is then elongated (By similarity). E3 ubiquitin-protein ligase activity is activated upon binding to neddylated form of the ECS complex. Mediates 'Lys-6', 'Lys-48'-and 'Lys-63'-linked polyubiquitination. May play a role in myelopoiesis (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...