Podxl (NM_013723) Mouse Recombinant Protein

CAT#: TP508097

Purified recombinant protein of Mouse podocalyxin-like (Podxl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208097 representing NM_013723
Red=Cloning site Green=Tags(s)

MPPTTALSALLLLLLSPASHSHNGNETSTSAIKSSTVQSHQSATTSTEVTTGHPVASTLASTQPSNPTPF
TTSTQSPSMPTSTPNPTSNQSGGNLTSSVSEVDKTKTSSPSSTAFTSSSGQTASSGGKSGDSFTTAPTTT
LGLINVSSQPTDLNTTSKLLSTPTTDNTTSPQQPVDSSPSTASHPVGQHTPAAVPSSSGSTPSTDNSTLT
WKPTTHKPLGTSEATQPLTSQTPGITTLPVSTLQQSMASTVGTTTEEFTHLISNGTPVAPPGPSTPSPIW
AFGNYQLNCEPPIRPDEELLILNLTRASLCERSPLDEKEKLVELLCHSVKASFKPAEDLCTLHVAPILDN
QAVAVKRIIIETKLSPKAVYELLKDRWDDLTEAGVSDMKLGKEGPPEVNEDRFSLPLIITIVCMASFLLL
VAALYGCCHQRISQRKDQQRLTEELQTVENGYHDNPTLEVMETPSEMQEKKVVNLNGELGDSWIVPLDNL
TKDDLDEEEDTHL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_038751
Locus ID 27205
UniProt ID Q9R0M4
Refseq Size 5330
Cytogenetics 6 12.57 cM
Refseq ORF 1509
Synonyms AW121214; Ly102; PC; PCLP-1; Pclp1; Podxl1
Summary Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...