Apex2 (NM_029943) Mouse Recombinant Protein

CAT#: TP508278

Purified recombinant protein of Mouse apurinic/apyrimidinic endonuclease 2 (Apex2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208278 protein sequence
Red=Cloning site Green=Tags(s)

MLRVVSWNINGIRSPLQGLACQEPSSCPTALRRVLDELDADIVCLQETKVTRDVLTEPLAIVEGYNSYFS
FSRSRSGYSGVATFCKDSATPVAAEEGLSGVFATLNGDIGCYGNMDEFTQEELRVLDSEGRALLTQHKIR
TLEGKEKTLTLINVYCPHADPGKPERLTFKMRFYRLLQMRAEALLAAGSHVIILGDLNTAHRPIDHCDAS
SLECFEEDPGRKWMDGLLSNPGDEAGPHIGLFMDSYRYLHPKQQRAFTCWSVVSGARHLNYGSRLDYVLG
DRALVIDTFQASFLLPEVMGSDHCPVGAVLNVSCVPAKQCPALCTRFLPEFAGTQLKILRFLVPLEQEPV
REQQVLQPSHQIQAQRQPRKACMHSTRLRKSQGGPKRKQKNLMSYFQPSSSLSQTSGVELPTLPLVGPLT
TPKTAEEVATATVLEEKNKVPESKDEKGERTAFWKSMLSGPSPMPLCGGHREPCVMRTVKKTGPNFGRQF
YMCARPRGPPSDPSSRCNFFLWSRPS

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 57.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_084219
Locus ID 77622
UniProt ID Q68G58
Refseq Size 1903
Cytogenetics X F3
Refseq ORF 1551
Synonyms ape2; C430040P13Rik
Summary Function as a weak apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway of DNA lesions induced by oxidative and alkylating agents. Initiates repair of AP sites in DNA by catalyzing hydrolytic incision of the phosphodiester backbone immediately adjacent to the damage, generating a single-strand break with 5'-deoxyribose phosphate and 3'-hydroxyl ends. Displays also double-stranded DNA 3'-5' exonuclease, 3'-phosphodiesterase activities. Shows robust 3'-5' exonuclease activity on 3'-recessed heteroduplex DNA and is able to remove mismatched nucleotides preferentially. Shows fairly strong 3'-phosphodiesterase activity involved in the removal of 3'-damaged termini formed in DNA by oxidative agents. In the nucleus functions in the PCNA-dependent BER pathway. Required for somatic hypermutation (SHM) and DNA cleavage step of class switch recombination (CSR) of immunoglobulin genes. Required for proper cell cycle progression during proliferation of peripheral lymphocytes.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...