Sgo1 (NM_028232) Mouse Recombinant Protein
CAT#: TP508287
Purified recombinant protein of Mouse shugoshin 1 (Sgo1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR208287 representing NM_028232
Red=Cloning site Green=Tags(s) MAKERCQKRSFQDTLEDIKNRMKEKRNKNLAGIGKRKSFIVAPGQVPTNTATLLRYYQDNNRLLVLALEN EKSKVREAQDVILQLRKECYYLTCQLYALKEKLTSRQSEETTQNWKGRPSDVVSSIDNTTRDLSGKSLQQ IAVEETDCPYQTTEPSPAVTPETQGCDFDSGKVESTDEVLPRTISIRRHLRKDFSNISHSTTLEDCKASP RVAQSLEVKGSRCREVTVTLHRLENVCLWNKDQISLCSRLINPAKITETEVILSSKPEQIESKHKRARKR RAEQRRTKQRCKSKSSLRSKGNKNKDKQGLPPTTLDGGIGSCDAYDFNLKGTVHPTPFRQKMNNGCNKET DSSNSEVSDLECSTSEDESDDLYLPPSKRLRDYRESERAVTRPRSKRGLQYPDGKERKEVLPSTAPTGIP PETQESPRCSLKDVTNILQCPRVKIRKPSLPPKRREDSPAVALTKRRCSTIKSYKEPTLASKLRRGDPFT DLCFLNSPIFKQKRGMRCPKRRTKQTQ myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 59 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_082508 |
Locus ID | 72415 |
UniProt ID | Q9CXH7 |
Refseq Size | 3609 |
Cytogenetics | 17 C |
Refseq ORF | 1551 |
Synonyms | 3300001M08Rik; C81037; Sgo1; Sgol1 |
Summary | Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphorylation of the STAG2 subunit of cohesin complex at the centromere, ensuring cohesin persistence at centromere until cohesin cleavage by ESPL1/separase at anaphase. Essential for proper chromosome segregation during mitosis and this function requires interaction with PPP2R1A. Its phosphorylated form is necessary for chromosome congression and for the proper attachment of spindle microtubule to the kinetochore. Necessary for kinetochore localization of PLK1 and CENPF. May play a role in the tension sensing mechanism of the spindle-assembly checkpoint by regulating PLK1 kinetochore affinity. Involved in centromeric enrichment of AUKRB in prometaphase.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |