Wrap53 (NM_144824) Mouse Recombinant Protein
CAT#: TP508531
Purified recombinant protein of Mouse WD repeat containing, antisense to Trp53 (Wrap53), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR208531 protein sequence
Red=Cloning site Green=Tags(s) MKTSEERLLAPDSLPPDLAPAPVPQGSPAEKNTDFEPVPPPCGGDDQPQLATDPVASLVVSQELQQGDSV PLEVEFNTSSELSPGIEEQDVSEHASLPGEETNLPELESGEATEGVSEERAEVDEGDTFWTYSFSQVPRY LSGSWSEFSTRSENFLKGCKWAPDGSCILTNSADNVLRIYNLPPELYSEQEQVDYAEMVPVLRMVEGDTI YDYCWYSLMSSTQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGF NRTVRVFSTSRPGRDCEVRATFAKKQGQSGIISCIAFSPSQPLYACGSYGRTIGLYAWDDGSPLALLGGH QGGITHLCFHPDGNLFFSGARKDAELLCWDLRQPGHLLWSLSREVTTNQRIYFDLDPSGQFLVSGNTSGV VSVWDISGALSDDSKLEPVVTFLPQKDCTNGVSLHPTLPLLATASGQRVFPEPTNSGDEGELELELPLLS LCHAHPECQLQLWWCGGGPDPSSPVDDQDEKGQRRTEAVGMS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 58.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659073 |
Locus ID | 216853 |
UniProt ID | Q8VC51 |
Refseq Size | 1896 |
Cytogenetics | 11 B3 |
Refseq ORF | 1599 |
Synonyms | BC021790; Wdr79 |
Summary | RNA chaperone that plays a key role in telomere maintenance and RNA localization to Cajal bodies (PubMed:29804836). Specifically recognizes and binds the Cajal body box (CAB box) present in both small Cajal body RNAs (scaRNAs) and telomerase RNA template component (TERC) (PubMed:29804836). Essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex essential for the replication of chromosome termini that elongates telomeres in most eukaryotes (By similarity). In the telomerase holoenzyme complex, required to stimulate the catalytic activity of the complex (PubMed:29804836). Acts by specifically binding the CAB box of the TERC RNA and controlling the folding of the CR4/CR5 region of the TERC RNA, a critical step for telomerase activity (By similarity). In addition, also controls telomerase holoenzyme complex localization to Cajal body (By similarity). During S phase, required for delivery of TERC to telomeres during S phase and for telomerase activity (By similarity). In addition to its role in telomere maintenance, also required for Cajal body formation, probably by mediating localization of scaRNAs to Cajal bodies (By similarity). Also plays a role in DNA repair: phosphorylated by ATM in response to DNA damage and relocalizes to sites of DNA double-strand breaks to promote the repair of DNA double-strand breaks (By similarity). Acts by recruiting the ubiquitin ligase RNF8 to DNA breaks and promote both homologous recombination (HR) and non-homologous end joining (NHEJ) (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |