Ythdf1 (NM_173761) Mouse Recombinant Protein

CAT#: TP508856

Purified recombinant protein of Mouse YTH N6-methyladenosine RNA binding protein 1 (Ythdf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208856 protein sequence
Red=Cloning site Green=Tags(s)

MSATSVDPQRTKGQDNKVQNGSLHQKDAVHDNDFEPYLSGQSNPSNSYPSMSDPYLSSYYPPSIGFPYSL
SEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQ
QTQSSAYGSSYTYPPSSLGGTVVDGQTGFHSDSLNKAPGMNSLEQGMVGLKIGDVTTSAVKTVGSVVNSV
ALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPIVGGALPPPPIKHNMDIGTWDNKGPA
PKASAPQQTPSPQAAPQPQQVAQPLPVQPPPLVQPQYQSPQQPLQPRWVAPRNRNAAFGQSGGANSDSNS
VGNAQPTSAPSVESHPVLEKLKAAHSYNPKEFDWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR
LDGAFRSMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWIFVKDVPNNQLR
HIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEEVVRKERQNRNKQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 60.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_776122
Locus ID 228994
UniProt ID P59326
Refseq Size 3199
Cytogenetics 2 H4
Refseq ORF 1680
Synonyms 2210410K23Rik; 8030473O16
Summary Specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency (PubMed:30401835). M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability (PubMed:30401835). Acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation (By similarity). Required to facilitate learning and memory formation in the hippocampus by enhancing protein synthesis upon neuronal stimulation: in response to neuronal stimulation, binds to m6A-containing neuronal mRNAs, promoting their translation, thereby contributing to learning and memory (PubMed:30401835). Acts as a regulator of axon guidance by binding to m6A-containing ROBO3 transcripts, thereby promoting their translation (PubMed:30843071). Acts as a negative regulator of antigen cross-presentation in myeloid dendritic cells (PubMed:30728504). Acts by binding and promoting translation of m6A-containing transcripts encoding proteins involved in lysosomal degradation and phagosome maturation, leading to increased antigen degradation in myeloid dendritic cells (PubMed:30728504). In the context of tumorigenesis, negative regulation of antigen cross-presentation limits the anti-tumor response by reducing efficiency of tumor-antigen cross-presentation (PubMed:30728504).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...