Chaf1b (NM_028083) Mouse Recombinant Protein
CAT#: TP509007
Purified recombinant protein of Mouse chromatin assembly factor 1, subunit B (p60) (Chaf1b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR209007 representing NM_028083
Red=Cloning site Green=Tags(s) MEPGNLTWVSEFVFLGFSEIWELQVFLFVVFLCVYSTTVVGNLLIIVTVSSDPRLHTPMYFLLRNLAVLD LCFSSVTAPKMLVDFLSEKKTISYRGCMVQIFFFHFLGGAMVFFLSVMAYDRLVAISRPLHYVTIMNSQL CMGLVVASWVGGFAHSIVQLSLMLPLPFCGPNVLDNFYCDVPQVLRLACMDTSLLEFLMISNSGMLDVIW FFLLLISYLVILVMLRSHSGEARRKAASTCTTHIIVVSMIFIPSIYLYARPFTPFTMDKAVSISHTVMTP MLNPMIYTLRNQEMQAAMKRLAKRLALCNRE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 63.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_082359 |
Locus ID | 110749 |
UniProt ID | Q9D0N7 |
Refseq Size | 1913 |
Cytogenetics | 16 54.96 cM |
Refseq ORF | 933 |
Synonyms | 2600017H24Rik; C76145; CAF-I p60; CAF-Ip60; CAF1; CAF1A; CAF1P60; MPHOSPH7 |
Summary | Complex that is thought to mediate chromatin assembly in DNA replication and DNA repair. Assembles histone octamers onto replicating DNA in vitro. CAF-1 performs the first step of the nucleosome assembly process, bringing newly synthesized histones H3 and H4 to replicating DNA; histones H2A/H2B can bind to this chromatin precursor subsequent to DNA replication to complete the histone octamer (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |