Sh3bp1 (BC004598) Mouse Recombinant Protein

CAT#: TP509303

Purified recombinant protein of Mouse SH3-domain binding protein 1 (cDNA clone MGC:6037 IMAGE:3584958), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209303 protein sequence
Red=Cloning site Green=Tags(s)

MAESFKELDPDSSMGKALEMTCAIQNQLARILAEFEMTLERDVLQPLSRLSEEELPAILKHKKSLQKLVS
DWNTLKSRLSQAAKNSGSNQGLGGASGSHTHTTTANKVEMLKEEEEELKKKVEQCKDEYLADLYHFSTKE
DSYANYFIHLLEIQADYHRKSLTSLDTALAELRDNHNQADHSPLTTAAPFSRVYGVSLRTHLQDLGRDIA
LPIEACVLLLLSEGMQEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLM
TSDLYDDWMRAASLKEPGARLEALHDVCSRLPQENFNNLRYLMKFLALLAEEQDVNKMTPSNIAIVLGPN
LLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQNADTLFPGDINFNVSGIFPGLAPQEKVSSQQVSEELP
PVTVPAPATTPAPTLAPASMAVRERTEADLPKPTSPKVSRNPTETAASAEDMTRKTKRPAPARPTMPPPQ
PSSTRSSPPAPSLPPGSVSPGTPQALPRRLVGTSLRAPTMPPPLPPVPPQPARRQSRRLPASPVISNMPA
QVDQGVATEDREGPEAVGGHPPPPALPPQPRPRGLISETE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 65.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 20401
Refseq Size 2224
Cytogenetics 15 E1
Refseq ORF 1800
Synonyms 3BP-1
Summary GTPase activating protein (GAP) which specifically converts GTP-bound Rho-type GTPases including RAC1 and CDC42 in their inactive GDP-bound form (PubMed:7621827). By specifically inactivating RAC1 at the leading edge of migrating cells, it regulates the spatiotemporal organization of cell protrusions which is important for proper cell migration. Also negatively regulates CDC42 in the process of actin remodeling and the formation of epithelial cell junctions. Through its GAP activity toward RAC1 and/or CDC42 plays a specific role in phagocytosis of large particles. Specifically recruited by a PI3 kinase/PI3K-dependent mechanism to sites of large particles engagement, inactivates RAC1 and/or CDC42 allowing the reorganization of the underlying actin cytoskeleton required for engulfment. It also plays a role in angiogenesis and the process of repulsive guidance as part of a semaphorin-plexin signaling pathway. Following the binding of PLXND1 to extracellular SEMA3E it dissociates from PLXND1 and inactivates RAC1, inducing the intracellular reorganization of the actin cytoskeleton and the collapse of cells (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...