Leo1 (NM_001039522) Mouse Recombinant Protein
CAT#: TP509896
Purified recombinant protein of Mouse Leo1, Paf1/RNA polymerase II complex component (Leo1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR209896 protein sequence
Red=Cloning site Green=Tags(s) MADMEDLFGSEAESEAERKDSESESDSDSDQDNGASGSNASGSESDQDDRGDSGQPSNKELFGDDSEEEG ASHHSGSDNHSERSDNRSEASERSDHEDNEPSDEDQHSGSEAHNDDDDEGHRSDEGSRHSEAEGSEKAQS DDEKWDGEDKSDQSDDEKLQNSDDEDREQGSDEDKLQNSDDDEEKMQNTDDEDRAQISDDDRQQLSEEEK GNSDDEHPVASDNDEEKQNSDDEDQPQVSDEEKMQNSDDERPQVSDEDGRRSDGEEEQDQKSESARGSDS EDEVLRLKRKNAIPSDSEADSDTEVPKDNNGTMDLFGGADDISSGSDGEDKPPTPGQPVDENGLPQDQQE EEPIPETRIEVEIPKVNTDLGNDLYFVKLPNFLSVEPRPFDPQYYEDEFEDEEMLDEEGRTRLKLKVENT IRWRIRRDEEGNEIKESNARIVKWSDGSMSLHLGNEVFDVYKAPLQGDHNHLFIRQGTGLQGQAVFKTKL TFRPHSTDSDTHRKMTLSLADRCSKTQKIRILPMAGRDPECQRTEMIKKEEERLRASIRRESQQRRMREK QHQRGLSASYLEPDRYDEEEEGEESVSLAAIKNRYKGGIREERARIYSSDSDEGSEEDKAQRLLKAKKLN SDEEGESSGKRKAEDDDKANKKHKKYVISDEEEEEDD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 75.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034611 |
Locus ID | 235497 |
UniProt ID | Q5XJE5 |
Refseq Size | 2192 |
Cytogenetics | 9 D |
Refseq ORF | 2004 |
Synonyms | Gm185 |
Summary | Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of KMT2A/MLL1. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. Involved in polyadenylation of mRNA precursors. Connects PAF1C to Wnt signaling (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |