Dtx3l (NM_001013371) Mouse Recombinant Protein

CAT#: TP510070

Purified recombinant protein of Mouse deltex 3-like, E3 ubiquitin ligase (Dtx3l), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR210070 protein sequence
Red=Cloning site Green=Tags(s)

MASSPDPPSPLLVRLRESIPKAHRKLEIYFQSRASGGGECSVQPVGPSAPDTYEVKFLKKADKEKVLKKS
EHEMLVHNKPVTIVLETTKKPVEDLRPRLPSLTQPVETPSSRPPSLTGSLDEALCDDIHPQDGLVSNSVD
SVVQKIFLAVTAELNCDLLSKEQRASITTVCPHIIKSMEGSDGIKKVCGNFKDIEKIHHFLSEQLLEREQ
KRKGSEQKRKCAPQKHTPPDVEREPPDQSSIQVPVLLLEYFKHVNPGRLEFIEYKFGVNIEIQASSPNMV
TVGFTSSPFGNVEEASQSFVRDFQKCSQSLKQDCISLEEHQRAKEVRQELSRCFPKLLIKGQGRTLTLLG
SPADISAATEKVSQGLGLRPVKITASGYTTGIEVDSTRFKLLEPELLQEISEIEQKFNTRGKVQEKGQKT
CILFVPKDKDLDLSVQSYTGFTDAFQRATWQLRTEVLSLKGLGKERARLHNTKFADNFKKEHPNVHFVTS
QESVTLTGLPHHLAQAMQYVSKRMGLAPSSGEKLAMDQETPMEISSSDPHGGQQENAALPAPRGTSSSPA
ASKGTEDYCVICMDTISNKHVLPKCKHEFCTSCISKAMLIKPVCPVCLTSYGIQKGNQPEGTMSYSTQKG
SLPGYEGCGTIVINYEIKDGIQTKEHPNPGKAYHGTRRTAYLPDNTEGRKVLDLLHEAFKH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 76.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001013389
Locus ID 209200
UniProt ID Q3UIR3
Refseq Size 5181
Cytogenetics 16 B3
Refseq ORF 2076
Synonyms AU042200; BC023741
Summary E3 ubiquitin-protein ligase which, in association with ADP-ribosyltransferase PARP9, plays a role in DNA damage repair and in interferon-mediated antiviral responses. Monoubiquitinates several histones, including histone H2A, H2B, H3 and H4. In response to DNA damage, mediates monoubiquitination of 'Lys-91' of histone H4 (H4K91ub1). The exact role of H4K91ub1 in DNA damage response is still unclear but it may function as a licensing signal for additional histone H4 post-translational modifications such as H4 'Lys-20' methylation (H4K20me). PARP1-dependent PARP9-DTX3L-mediated ubiquitination promotes the rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80, and BRCA1 to DNA damage sites. By monoubiquitinating histone H2B HIST1H2BH/H2BJ and thereby promoting chromatin remodeling, positively regulates STAT1-dependent interferon-stimulated gene transcription and thus STAT1-mediated control of viral replication. Independently of its catalytic activity, promotes the sorting of chemokine receptor CXCR4 from early endosome to lysosome following CXCL12 stimulation by reducing E3 ligase ITCH activity and thus ITCH-mediated ubiquitination of endosomal sorting complex required for transport ESCRT-0 components HGS and STAM. In addition, required for the recruitment of HGS and STAM to early endosomes.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...