Sh2b1 (BC051978) Mouse Recombinant Protein

CAT#: TP510304

Purified recombinant protein of Mouse SH2B adaptor protein 1 (cDNA clone MGC:62271 IMAGE:6401205), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR210304 protein sequence
Red=Cloning site Green=Tags(s)

MNGAPSPEDGVFPSPPALPPPPPPSWQEFCESHARAAALDLARRFRLYLASHPQYAEPGAEAAFSGRFAE
LFLQHFEAEVARASGSLSPPVLAPLSPGVEIPPSHDLSLESCRVGGPLAVLGPSRSSEDLAGPLPSSVPS
STTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGAVDSPSQAGPLETTSGPPVLGGNSNSNSSGGAGTVG
RALANDGTSPGERWTHRFERLRLSRGGGTLKDGAGMIQREELLSFMGAEEAAPDPAGVGRGGGAAGLTSG
GGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSTITDVRTATALEMPDRENTFVVKVEG
PSEYILETSDALHVKAWVSDIQECLSPGPCPAISPRPMTLPLAPGTSFFTKDNTDSLELPCLNHSESLPS
QDLLLGPSESNDRLSQGAYGGLSDRPSASFSPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPL
STPYPPLDTPEAATGSFLFQGESEGGEGDQPLSGYPWFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETR
RGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSQRQ
QGEQSRSAGEEVPVHPRSENGAPPVTQPSPLNPLHGQIPHILGQKRRRGRQKLRQPQPQQPKRGKRKRKR
AVEGSRKSWSPWLSWSPWLNWKRP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 77.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 20399
UniProt ID Q91ZM2
Refseq Size 2902
Cytogenetics 7 69.06 cM
Refseq ORF 2172
Synonyms SH2-Bb, SH2-B, mKIAA1299
Summary Adapter protein for several members of the tyrosine kinase receptor family. Involved in multiple signaling pathways mediated by Janus kinase (JAK) and receptor tyrosine kinases, including the receptors of insulin (INS), insulin-like growth factor I (IGF1), nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), glial cell line-derived neurotrophic factor (GDNF), platelet-derived growth factor (PDGF) and fibroblast growth factors (FGFs). In growth hormone (GH) signaling, autophosphorylated ('Tyr-813') JAK2 recruits SH2B1, which in turn is phosphorylated by JAK2 on tyrosine residues. These phosphotyrosines form potential binding sites for other signaling proteins. GH also promotes serine/threonine phosphorylation of SH2B1 and these phosphorylated residues may serve to recruit other proteins to the GHR-JAK2-SH2B1 complexes, such as RAC1. In leptin (LEP) signaling, binds to and potentiates the activation of JAK2 by globally enhancing downstream pathways. In response to leptin, binds simultaneously to both, JAK2 and IRS1 or IRS2, thus mediating formation of a complex of JAK2, SH2B1 and IRS1 or IRS2. Mediates tyrosine phosphorylation of IRS1 and IRS2, resulting in activation of the PI 3-kinase pathway. Acts as positive regulator of NGF-mediated activation of the Akt/Forkhead pathway; prolongs NGF-induced phosphorylation of AKT1 on 'Ser-473' and AKT1 enzymatic activity. Enhances the kinase activity of the cytokine receptor-associated tyrosine kinase JAK2 and of other receptor tyrosine kinases, such as FGFR3 and NTRK1. For JAK2, the mechanism seems to involve dimerization of both, SH2B1 and JAK2. Enhances RET phosphorylation and kinase activity (By similarity). Isoforms seem to be differentially involved in IGF-I and PDGF-induced mitogenesis, according the order: isoform 3 > isoform 4 > isoform 1 > isoform 2.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...