Rps6ka5 (NM_153587) Mouse Recombinant Protein

CAT#: TP510996

Purified recombinant protein of Mouse ribosomal protein S6 kinase, polypeptide 5 (Rps6ka5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR210996 protein sequence
Red=Cloning site Green=Tags(s)

MEGEGGGSGGAGTSGDSGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKISG
HDAGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFT
HLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERAY
SFCGTIEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQE
MSTVAKDLLQRLLMKDPKKRLGCGPRDAEEIKEHLFFEKIKWDDLAAKKVPAPFKPVIRDELDVSNFAEE
FTEMDPTYSPAALPQSSERLFQGYSFVAPSILFKRNAAVIDPLQFHMGVDRPGVTNVARSAMMKDSPFYQ
HYDLDLKDKPLGEGSFSICRKCVHKKTNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHDQ
VAASAQPPGQVVLCSLLLLALLFNRSLTRKPVTWTWLVHSTSQLPPLPPPMPEIVLFILLSDNGQLHTFL
VMELLNGGELFERIKRKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKVIDF
GFARLKPPDNQPLKTPCFTLHYAAPELLTHNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVE
IMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGS
SGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKRTSTSTETRSSSSESSRSSSSQSHGKTTP
TKTLQPSNPTEGSNPDTLFQFSD

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 96.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_705815
Locus ID 73086
UniProt ID Q8C050
Refseq Size 4406
Cytogenetics 12 E
Refseq ORF 2592
Synonyms 3110005L17Rik; 6330404E13Rik; AI854034; MSK1; MSPK1; RLPK; RLSK; S6K-alpha-5
Summary Serine/threonine-protein kinase that is required for the mitogen or stress-induced phosphorylation of the transcription factors CREB1 and ATF1 and for the regulation of the transcription factors RELA, STAT3 and ETV1/ER81, and that contributes to gene activation by histone phosphorylation and functions in the regulation of inflammatory genes (By similarity)(PubMed:11553624, PubMed:11909979, PubMed:16806820). Phosphorylates CREB1 and ATF1 in response to mitogenic or stress stimuli such as UV-C irradiation, epidermal growth factor (EGF) and anisomycin (PubMed:11909979). Plays an essential role in the control of RELA transcriptional activity in response to TNF and upon glucocorticoid, associates in the cytoplasm with the glucocorticoid receptor NR3C1 and contributes to RELA inhibition and repression of inflammatory gene expression (PubMed:12628924, PubMed:16806820). In skeletal myoblasts is required for phosphorylation of RELA at 'Ser-276' during oxidative stress (PubMed:12628924). In erythropoietin-stimulated cells, is necessary for the 'Ser-727' phosphorylation of STAT3 and regulation of its transcriptional potential (PubMed:11553624). Phosphorylates ETV1/ER81 at 'Ser-191' and 'Ser-216', and thereby regulates its ability to stimulate transcription, which may be important during development and breast tumor formation (By similarity). Directly represses transcription via phosphorylation of 'Ser-1' of histone H2A (By similarity). Phosphorylates 'Ser-10' of histone H3 in response to mitogenics, stress stimuli and EGF, which results in the transcriptional activation of several immediate early genes, including proto-oncogenes c-fos/FOS and c-jun/JUN (PubMed:15870105, PubMed:16517600). May also phosphorylate 'Ser-28' of histone H3 (PubMed:11441012, PubMed:15870105). Mediates the mitogen- and stress-induced phosphorylation of high mobility group protein 1 (HMGN1/HMG14) (By similarity). In lipopolysaccharide-stimulated primary macrophages, acts downstream of the Toll-like receptor TLR4 to limit the production of pro-inflammatory cytokines (PubMed:18690222). Functions probably by inducing transcription of the MAP kinase phosphatase DUSP1 and the anti-inflammatory cytokine interleukin 10 (IL10), via CREB1 and ATF1 transcription factors (PubMed:18690222). Plays a role in neuronal cell death by mediating the downstream effects of excitotoxic injury (PubMed:12807421). Phosphorylates TRIM7 at 'Ser-106' in response to growth factor signaling via the MEK/ERK pathway, thereby stimulating its ubiquitin ligase activity (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...