Spata18 (NM_178387) Mouse Recombinant Protein

CAT#: TP513524

Purified recombinant protein of Mouse spermatogenesis associated 18 (Spata18), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR213524 representing NM_178387
Red=Cloning site Green=Tags(s)

MAESLKKLAKSESLQALQDKVTYWVNDYNSNSCDQNLNYCIELIEQVAKVQAQLFGILTVTAQEGGNNEG
VETIKCRLLPLLQTSFSSVNMGKTAESEMCATQDFQLRSKNRDNSPDQDQHQSDNESFSETQPTQVQDDL
AESGKSLEGAKNGSTISLLAAEEEINQLKKQLKSLQAQEDARHKTSENRRSEALKSDHRSTKRTQDQRPQ
DVVSNYEKHLQNLKEEIAVLSAEKSGLQGRSARSPSPSTGTRSHRRGRSRSHSRSRSHSRSNSPCTTVAK
IRSPSPNRAKMSSVARKAALLSRFSDAYSQARLDAQCLLRRCIDRAETVQRIIYIATVEAFHVAKMAFRH
FKIRVRKMLTPSNVGSNTDFETAVSEYIVCHLDLYDSQSSVNDVIRAMNVNPKISFPPEVDFCLLTDFIQ
EICCIAFAMQSLEPPLDIAFGADGEIFNDCKYRRSYDSDFTAPLVFYHVWPALMENDCVIMKGEAVTKRG
AFWSSVRPVMRCRSRSLSPICPRNHFGISTVSRSRSPSPIRCTFARY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 60.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_848474
Locus ID 73472
UniProt ID Q0P557
Refseq Size 1949
Cytogenetics 5 C3.3
Refseq ORF 1611
Synonyms 1700067I02Rik
Summary Key regulator of mitochondrial quality that mediates the repairing or degradation of unhealthy mitochondria in response to mitochondrial damage. Mediator of mitochondrial protein catabolic process (also named MALM) by mediating the degradation of damaged proteins inside mitochondria by promoting the accumulation in the mitochondrial matrix of hydrolases that are characteristic of the lysosomal lumen. Also involved in mitochondrion degradation of damaged mitochondria by promoting the formation of vacuole-like structures (named MIV), which engulf and degrade unhealthy mitochondria by accumulating lysosomes. May have a role in spermatogenesis, especially in cell differentiation from late elongate spermatids to mature spermatozoa (By similarity). The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...