Syce2 (NM_001168246) Mouse Recombinant Protein
CAT#: TP514964
Purified recombinant protein of Mouse synaptonemal complex central element protein 2 (Syce2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR214964 protein sequence
Red=Cloning site Green=Tags(s) MERHGSWLRSQVAAPPVELKDQEPPAIVESGEHRQSENHEETPGSVAPSASCQLPGPFSSLDSSIETLKK KAQELIENINESRQKDHALMTNFRDSLKMKVSDLTEKLEERMYQVYSHHSKIIQERLQEFTQKMAKINHL EMELKQVCQTVETVYKDLCVQSEVPTCEEQNYKDGEC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001161718 |
Locus ID | 71846 |
UniProt ID | E9PYH4 |
Refseq Size | 929 |
Cytogenetics | 8 C3 |
Refseq ORF | 531 |
Synonyms | 1700013H19Rik; AA407907; Cesc1 |
Summary | Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complex assembly, stabilization and recombination.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |