Ndufab1 (NM_028177) Mouse Recombinant Protein
CAT#: TP515726
Purified recombinant protein of Mouse NADH:ubiquinone oxidoreductase subunit AB1 (Ndufab1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR215726 representing NM_028177
Red=Cloning site Green=Tags(s) MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSD APPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMC PQEIVDYIADKKDVYE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_082453 |
Locus ID | 70316 |
UniProt ID | Q9CR21, Q569N0 |
Refseq Size | 800 |
Cytogenetics | 7 F2 |
Refseq ORF | 468 |
Synonyms | 8kDa; 2210401F17Rik; 2310039H15Rik; 2610003B19Rik; 9130423F15Rik; ACP; CI-SDAP; SDAP |
Summary | Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Ndufab1产品