Spc24 (NM_026282) Mouse Recombinant Protein

CAT#: TP518082

Purified recombinant protein of Mouse SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae) (Spc24), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218082 representing NM_026282
Red=Cloning site Green=Tags(s)

MAAFRDMVEVSNWLLSLLGANRAEAQQRRLLGSYEQMMERLLEMQDGAYRQLRETLAVEEEVAQSLLELK
ECTRQGDTELQQLEVELQRTSKEDTCVQARLRQLITELQELREMEEELQRQERDVDEDNTVTIPSAVYVA
HLYHQISKIQWDYECEPGMIKGIHHGPTVAQPIHLDSAQLSPKFISDYLWSLVDTTWEPEP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 23.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080558
Locus ID 67629
UniProt ID Q9D083
Refseq Size 1349
Cytogenetics 9 A3
Refseq ORF 603
Synonyms 2410030K01Rik; AV109292; Spbc24
Summary Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...