Tctn1 (NM_001039153) Mouse Recombinant Protein

CAT#: TP518335

Purified recombinant protein of Mouse tectonic family member 1 (Tctn1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218335 representing NM_001039153
Red=Cloning site Green=Tags(s)

MGSRGLPPLLLVLLNCYTSSSTQVIAIPAAATPAVTKEDLNSTKATPTTLQPSLSPRTPGTPRAPERSGP
RPTPVTDVAALCVCDLLPAQCDVNCCCDPDCSPADFSIFSACSVPVVTGDRQFCSQKAAFYSMNLTADPP
HRDFKLIDQINPSVFCIHISNYKPALSFANPEVPDENNFDRLMQTSGGFTLSAESAVPSTAASDGPQPTK
YEYGAPLQTAGASSGSFLKLPSPLTSSLCADQNPAAFLVSQAFECSRRVDIEQCEGMEALSMAHYSSPAI
LRVPNSMTQVSIKIQSVMYRSLNHTLTQLEGHGVLRPSLVSTGQDRLCSNVVLQVKYSLLYTATGQIHEA
GLSLVLGTLSSAVSLLQQKFEIHFIQHGTKPVPLSGNPGYRVGLPLAAGFQPQKGSGIIQTTNRQGQFTI
LRSTSQQDCLASEGLRTPVLFGYNVQSGCQLRLTGTIPCGLLAQKVQDLLRGQAFPDYVAAFGNSRAQDV
QDWVPVHFVTYSSNMKGSCQLPVALAIEVKWTKYGSLLNPQARIVNVTAQLVSVPEPLPGPERTVVISTA
VTFVDVSAPAEAGFRAPPTINARLPFSFFFPFV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 63.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001034242
Locus ID 654470
UniProt ID Q8BZ64
Refseq Size 2068
Cytogenetics 5 F
Refseq ORF 1779
Synonyms G730031O11Rik; Tect1
Summary Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Regulator of Hedgehog (Hh), required for both activation and inhibition of the Hh pathway in the patterning of the neural tube. During neural tube development, it is required for formation of the most ventral cell types and for full Hh pathway activation. Functions in Hh signal transduction to fully activate the pathway in the presence of high Hh levels and to repress the pathway in the absence of Hh signals. Modulates Hh signal transduction downstream of SMO and RAB23.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...