Rps19 (NM_023133) Mouse Recombinant Protein
CAT#: TP519906
Purified recombinant protein of Mouse ribosomal protein S19 (Rps19), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR219906 representing NM_023133
Red=Cloning site Green=Tags(s) MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGA GVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAA ANKKH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 16.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_075622 |
Locus ID | 20085 |
UniProt ID | Q9CZX8 |
Refseq Size | 629 |
Cytogenetics | 7 A3 |
Refseq ORF | 435 |
Synonyms | Dsk3 |
Summary | Required for pre-rRNA processing and maturation of 40S ribosomal subunits.[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Prolonged hypernutrition impairs TREM2-dependent efferocytosis to license chronic liver inflammation and NASH development.
,null,
Immunity
,PubMed ID 36521495
[Rps19]
|
Documents
FAQs |
SDS |