Fdx1 (NM_007996) Mouse Recombinant Protein

CAT#: TP520323

Purified recombinant protein of Mouse ferredoxin 1 (Fdx1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220323 protein sequence
Red=Cloning site Green=Tags(s)

MAAAPGARLLRAACASVPFRGLDRCRLLVCGTGAGTAISPWTPSPRLHAEAGPGRPLSVSARARSSSEDK
ITVHFKNRDGETLTTKGKIGDSLLDVVIENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEEND
MLDLAFGLTDRSRLGCQVCLTKAMDNMTVRVPEAVADVRQSVDMSKNS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 20.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_032022
Locus ID 14148
UniProt ID P46656
Refseq Size 1227
Cytogenetics 9 A5.3
Refseq ORF 567
Synonyms ADRE
Summary Ferrodoxins are iron-sulfur proteins that facilitate monooxygenase reactions catalyzed by P450 enzymes. The protein encoded by this gene is present in the mitochondrial matrix and transfers electrons from ferredoxin reductase to steroidogenic mitochondrial cytochrome P450 proteins. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...