Ak4 (NM_001177602) Mouse Recombinant Protein

CAT#: TP521761

Purified recombinant protein of Mouse adenylate kinase 4 (Ak4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR221761 representing NM_001177602
Red=Cloning site Green=Tags(s)

MASKLLRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVIT
RLMMSELETRSAQHWLLDGFPRTLVQAEALDGICDVDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDF
NPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLF
SNKITPIQSKEAY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 25.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001171073
Locus ID 11639
UniProt ID Q9WUR9
Refseq Size 5136
Cytogenetics 4 46.84 cM
Refseq ORF 669
Synonyms Ak-3; Ak-4; Ak3; Ak3l1; AK 4; D4Ertd274e
Summary Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Efficiently phosphorylates AMP and dAMP using ATP as phosphate donor, but phosphorylates only AMP when using GTP as phosphate donor. Also displays broad nucleoside diphosphate kinase activity.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...