Hspb6 (NM_001012401) Mouse Recombinant Protein

CAT#: TP522204

Purified recombinant protein of Mouse heat shock protein, alpha-crystallin-related, B6 (Hspb6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222204 protein sequence
Red=Cloning site Green=Tags(s)

MEIPVPVQPSWLRRASAPLPGFSAPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVSTD
SGYFSVLLDVKHFLPEEISVKVVDDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEG
VLSIQATPASAQAQLPSPPAAK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 17.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001012401
Locus ID 243912
UniProt ID Q5EBG6
Refseq Size 1383
Cytogenetics 7 B1
Refseq ORF 489
Synonyms AA387366; Gm479; Hsp20
Summary Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Seems to have versatile functions in various biological processes. Plays a role in regulating muscle function such as smooth muscle vasorelaxation and cardiac myocyte contractility. May regulate myocardial angiogenesis implicating KDR. Overexpression mediates cardioprotection and angiogenesis after induced damage. Stabilizes monomeric YWHAZ thereby supporting YWHAZ chaperone-like activity.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...