Xpnpep3 (NM_177310) Mouse Recombinant Protein

CAT#: TP522865

Purified recombinant protein of Mouse X-prolyl aminopeptidase 3, mitochondrial (Xpnpep3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222865 representing NM_177310
Red=Cloning site Green=Tags(s)

MPSLLSTPKLAPVLARLRGLSGCMSCLQRRYSLQPAPVKKIPNRYLGQPSPVTHPHLLRPGEVTPGLSQV
EYALRRHKLMALVHKEAQGHSGTDHTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSFS
GKQLPSHKAMLFVPRRDPGRELWDGPRSGTDGAIALTGVDEAYPLEEFQHLLPKLRAETNMVWYDWMKPS
HAQLHSDYMQPLTEAKARSKNKVRSVQQLIQRLRLVKSPSEIKRMQIAGKLTSEAFIETMFASKAPIDEA
FLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVN
GRLLENTALIMLAITSGWMSMTLQTCLGHSLCSLEW

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 43.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_796284
Locus ID 321003
UniProt ID B7ZMP1
Refseq Size 3236
Cytogenetics 15 E1
Refseq ORF 1158
Synonyms APP3; E430012M05Rik
Summary Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Leu-Pro-Ala. Also shows low activity towards peptides with Ala or Ser at the P1 position. Promotes TNFRSF1B-mediated phosphorylation of MAPK8/JNK1 and MAPK9/JNK2, suggesting a function as an adapter protein for TNFRSF1B; the effect is independent of XPNPEP3 peptidase activity. May inhibit apoptotic cell death induced via TNF-TNFRSF1B signaling.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...