Chmp4c (NM_025519) Mouse Recombinant Protein
CAT#: TP524757
Purified recombinant protein of Mouse charged multivesicular body protein 4C (Chmp4c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR224757 protein sequence
Red=Cloning site Green=Tags(s) MSKLGKFFKGTRSSRARAAPSAQEALARLRETEEMLAKKQEYLENRIQRELALAKKHGSQNKRAALQALK RKKRFEKQLTQVDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKAVHDNMDLNKIDDLMQDITEQQD IAQEISEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPAQPSRKASMPSSVHRS RAASSRRAEEDDDFKQLAAWAT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079795 |
Locus ID | 66371 |
UniProt ID | Q9D7F7 |
Refseq Size | 1790 |
Cytogenetics | 3 A1 |
Refseq ORF | 699 |
Synonyms | 2010012P02Rik; 2210015K02Rik; 2310010I16Rik; Shax3; Snf7-3 |
Summary | Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Key component of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage: upon phosphorylation by AURKB, together with ZFYVE19/ANCHR, retains abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Deactivation of AURKB results in dephosphorylation of CHMP4C followed by its dissociation from ANCHR and VPS4 and subsequent abscission. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. CHMP4A/B/C are required for the exosomal release of SDCBP, CD63 and syndecan (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |