Ing1 (NM_011919) Mouse Recombinant Protein

CAT#: TP525175

Purified recombinant protein of Mouse inhibitor of growth family, member 1 (Ing1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
ING1 Antibody - middle region
    • 50 ug

CNY 4,628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR225175 protein sequence
Red=Cloning site Green=Tags(s)

MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDDYYEKFKRETDGTQKRRV
LHCIQRALIRSQELGDEKIQIVSQMVELVENRSRQVDSHVELFEAHQDISDGTGGSGKAGQDKSKSEAIT
QADKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEP
TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGESEKTMDKALEKSKKERAYNR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 32.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_036049
Locus ID 26356
UniProt ID Q9QXV3
Refseq Size 2813
Cytogenetics 8 A1.1
Refseq ORF 840
Synonyms 2610028J21Rik; AA407184; AI875420; mING1h; p33Ing1; p37Ing1b
Summary Isoform 1 inhibits p53-dependent transcriptional activation and may function as an oncoprotein. Isoform 2 acts as a negative growth regulator by cooperating with p53 in transcriptional activation of p53-responsive genes and may act as a tumor suppressor.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...