Ing1 (NM_011919) Mouse Recombinant Protein
CAT#: TP525175
Purified recombinant protein of Mouse inhibitor of growth family, member 1 (Ing1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR225175 protein sequence
Red=Cloning site Green=Tags(s) MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDDYYEKFKRETDGTQKRRV LHCIQRALIRSQELGDEKIQIVSQMVELVENRSRQVDSHVELFEAHQDISDGTGGSGKAGQDKSKSEAIT QADKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEP TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGESEKTMDKALEKSKKERAYNR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-MYC/DDK |
Predicted MW | 32.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036049 |
Locus ID | 26356 |
UniProt ID | Q9QXV3 |
Refseq Size | 2813 |
Cytogenetics | 8 A1.1 |
Refseq ORF | 840 |
Synonyms | 2610028J21Rik; AA407184; AI875420; mING1h; p33Ing1; p37Ing1b |
Summary | Isoform 1 inhibits p53-dependent transcriptional activation and may function as an oncoprotein. Isoform 2 acts as a negative growth regulator by cooperating with p53 in transcriptional activation of p53-responsive genes and may act as a tumor suppressor.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |