Bmx (NM_009759) Mouse Recombinant Protein
CAT#: TP526349
Purified recombinant protein of Mouse BMX non-receptor tyrosine kinase (Bmx), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR226349 protein sequence
Red=Cloning site Green=Tags(s) MESKSILEELLLKKSQQKKKMSPNNYKERLFVLTKTSLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEE QTPVERQYPFQIVYKDGLLYVYASNEESRCQWLKALQKEIRGNPHLLIKYHSGFFVDGKFLCCQQSCKAA PGCTLWEAYADLHIAISDEKHRAPTFPERLLKIPRAVPVLKMDASSSGAILPQYDSYSKKSCGSQPTSNI RYIPREDCPDWWQVRKLKSEEDIACSNQLERNIASHSTSKMSWGFPESSSSEEEENLHAYDWFAGNISRS QSEQLLRQKGKEGAFMVRNSSQMGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPKLI HYHQHNSAGMITRLRHPVSTKANKVPVSVALGSGIWELKREEITLLKELGNGQFGVVQLGQWKGQYDVAV KMIKEGAMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNYLKSHGKGLESCQLL EMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVF HYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSEVVVKVSQGHRLYRPQLASDTIYQIMYSCWHELPE KRPTFQQLLSAIEPLREQDKP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 75 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033889 |
Locus ID | 12169 |
UniProt ID | P97504 |
Refseq Size | 3005 |
Cytogenetics | X F5 |
Refseq ORF | 1956 |
Synonyms | Etk; Etk/Bmx; Tyro8 |
Summary | Non-receptor tyrosine kinase that plays central but diverse modulatory roles in various signaling processes involved in the regulation of actin reorganization, cell migration, cell proliferation and survival, cell adhesion, and apoptosis. Participates in signal transduction stimulated by growth factor receptors, cytokine receptors, G-protein coupled receptors, antigen receptors and integrins. Induces tyrosine phosphorylation of BCAR1 in response to integrin regulation. Activation of BMX by integrins is mediated by PTK2/FAK1, a key mediator of integrin signaling events leading to the regulation of actin cytoskeleton and cell motility. Plays a critical role in TNF-induced angiogenesis, and implicated in the signaling of TEK and FLT1 receptors, 2 important receptor families essential for angiogenesis. Required for the phosphorylation and activation of STAT3, a transcription factor involved in cell differentiation. Also involved in interleukin-6 (IL6) induced differentiation. Plays also a role in programming adaptive cytoprotection against extracellular stress in different cell systems, salivary epithelial cells, brain endothelial cells, and dermal fibroblasts. May be involved in regulation of endocytosis through its interaction with an endosomal protein RUFY1. May also play a role in the growth and differentiation of hematopoietic cells; as well as in signal transduction in endocardial and arterial endothelial cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |