Ccl2 (NM_011333) Mouse Recombinant Protein
CAT#: TP526804
Purified recombinant protein of Mouse chemokine (C-C motif) ligand 2 (Ccl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Ccl2" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR226804 protein sequence
Red=Cloning site Green=Tags(s) MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKL KREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSV GVTSVTVN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 16.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035463 |
Locus ID | 20296 |
UniProt ID | P10148 |
Refseq Size | 806 |
Cytogenetics | 11 49.82 cM |
Refseq ORF | 447 |
Synonyms | AI323594; HC11; JE; MCA; MCAF; MCP; MCP-; MCP-1; MCP1; Scy; Scya2; Sig; Sigje; SMC-C; SMC-CF |
Summary | This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis. [provided by RefSeq, Sep 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723768 | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 2 (Ccl2 / MCP-1) |
CNY 5,330.00 |