Nqo1 (NM_008706) Mouse Recombinant Protein
CAT#: TP527333
Purified recombinant protein of Mouse NAD(P)H dehydrogenase, quinone 1 (Nqo1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR227333 representing NM_008706
Red=Cloning site Green=Tags(s) MAARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPS ESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQN KKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKK RLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 31.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032732 |
Locus ID | 18104 |
UniProt ID | Q64669 |
Refseq Size | 1552 |
Cytogenetics | 8 54.08 cM |
Refseq ORF | 822 |
Synonyms | AV001255; Dia4; Dtd; Nmo-1; Nmo1; Nmor1; Ox-1; Ox1; Qr1 |
Summary | The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |