Pacrg (NM_027032) Mouse Recombinant Protein

CAT#: TP527589

Purified recombinant protein of Mouse PARK2 co-regulated (Pacrg), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR227589 protein sequence
Red=Cloning site Green=Tags(s)

MPKRTKLLPQQTFQVHQPRSLVSEGFTVKAMMKNSVVRGPPVAGAFKERPAKPTTFRKCYERGDFPIALE
HDSKGNKIAWKVEIEKLDYHHYLPLFFDGLSEMTFPYEFFARRGIHDMLEHGGNKILPVIPQLIIPIKNA
LNLRNRQIICVTLKVLQHLVVSSEMVGEALLPYYRQILPILNIFKNMNVNSGDGIDYSQQKRENIGDLIQ
ETLEAFERYGGEDAFINIKYMVPTYESCLLN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081308
Locus ID 69310
UniProt ID Q9DAK2
Refseq Size 1355
Cytogenetics 17 7.8 cM
Refseq ORF 726
Synonyms 1700008H23Rik
Summary Suppresses cell death induced by accumulation of unfolded Pael receptor (Pael-R, a substrate of Parkin). Facilitates the formation of inclusions consisting of Pael-R, molecular chaperones, protein degradation molecules and itself when proteasome is inhibited (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...