HAGHL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-HAGHL Antibody is: synthetic peptide directed towards the C-terminal region of Human HAGHL. Synthetic peptide located within the following region: PVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	hydroxyacylglutathione hydrolase-like
Database Link	NP_115680 Entrez Gene 84264 Human UniProt ID Q6PII5
Background	HAGHL is a hydrolase acting on ester bonds.
Synonyms	MGC2605
Note	Immunogen sequence homology: Human: 100%; Horse: 77%
Reference Data
Protein Pathways	Pyruvate metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.