HAGHL (NM_032304) Human Recombinant Protein
CAT#: TP300832
Recombinant protein of human hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 2, 20 µg
View other "HAGHL" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200832 protein sequence
Red=Cloning site Green=Tags(s) MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLR PGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAG CGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTV PSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAP HD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115680 |
Locus ID | 84264 |
UniProt ID | Q6PII5, B4DED4 |
Refseq Size | 1386 |
Cytogenetics | 16p13.3 |
Refseq ORF | 846 |
Summary | Hydrolase acting on ester bonds.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404116 | HAGHL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410246 | HAGHL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404116 | Transient overexpression lysate of hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 1 |
CNY 3,080.00 |
|
LY410246 | Transient overexpression lysate of hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 2 |
CNY 3,080.00 |
|
PH300832 | HAGHL MS Standard C13 and N15-labeled recombinant protein (NP_115680) |
CNY 19,520.00 |
|
TP761798 | Purified recombinant protein of Human hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |