RAB4B Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Human, Mouse, Pig, Dog, Horse, Zebrafish, Brugia malayi
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAB4B antibody is: synthetic peptide directed towards the middle region of Human RAB4B. Synthetic peptide located within the following region: SPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	RAB4B, member RAS oncogene family
Database Link	NP_057238 Entrez Gene 19342 MouseEntrez Gene 403956 DogEntrez Gene 53916 Human UniProt ID P61018
Background	RAB proteins, such as RAB4B, are members of the RAS superfamily of small GTPases that are involved in vesicular trafficking.
Synonyms	FLJ78649; MGC52123
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Goat: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.