RAB4B (NM_016154) Human Recombinant Protein
CAT#: TP308302
Recombinant protein of human RAB4B, member RAS oncogene family (RAB4B), 20 µg
View other "RAB4B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208302 protein sequence
Red=Cloning site Green=Tags(s) MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERF RSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFA QENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDASLRQLRQPRSAQAVAPQP CGC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057238 |
Locus ID | 53916 |
UniProt ID | P61018, A0A024R0K8 |
Refseq Size | 1200 |
Cytogenetics | 19q13.2 |
Refseq ORF | 639 |
Summary | RAB proteins, such as RAB4B, are members of the RAS superfamily of small GTPases that are involved in vesicular trafficking (He et al., 2002 [PubMed 12450215]).[supplied by OMIM, Aug 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414149 | RAB4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414149 | Transient overexpression lysate of RAB4B, member RAS oncogene family (RAB4B) |
CNY 3,080.00 |
|
PH308302 | RAB4B MS Standard C13 and N15-labeled recombinant protein (NP_057238) |
CNY 19,520.00 |