Atoh8 (NM_153778) Mouse Tagged ORF Clone

CAT#: MR204653

  • TrueORF®

Atoh8 (Myc-DDK-tagged) - Mouse atonal homolog 8 (Drosophila) (Atoh8)

ORF Plasmid: DDK tGFP



  "NM_153778" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 4933425C05Rik; bHLHa21; Hath6; Math6; okadin
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204653 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCACATCCCGGTCCTCGAGGACGGGCCGTGGAAGACTGTGTGCGTTAAAGAACTGAACGGCCTCA
AGAAGCTCAAGCGGAAAGGCAAGGAGCCGGTGCGGCGCGCGAATGGCTATAAAACTTTCCGATTGGACTT
GGAAGCTCCCGAGCTCGGCGCCACAGTCAGCACCACCGCCGCCACCAACGGGCTTCGGGACAGGACACAA
CCGTTCCCGATCGCGACCCCAGTACCAGCCTCAGTGGCGCCGGCGGTTCCTCCAGGTGGAGGCACAGACA
CAGCCAGGGAATTCCGGGGCATCAGAGCGCCTGAGGTCTCTGACGCGCGCAAACGCGGTTTCGCTCTGGG
CACAGTGGGACCGGGACTACCCACGCCACCGCCGCCTCCCGCATCTCAGAGCTTGGCACCCGGGGATCCC
GAGGCGCACTCCTTCCGCGAGCAGGCTCTGCGTCCCCGCATCTTGCTGTGCGCCCCTCCCGCGCGTCCCA
CACAATCCGCGCCTCTCGCACCCCCAGCGGCGCCACAAGAGTCCCCCGTGCGCCCTGCGCCCCCCACGCG
CCCGGGGGAAAGTTCCTACTCGTCAATTTCACACGTAATTTACAATAACCACCCGGATTCTTCCGCGTCG
CCTAGGAAACGGCCAGGCGAAGCGACCGCCGCCTCAACGGAGATCAAAGCCCTGCAGCAGACCCGGAGGC
TTCTGGCCAACGCCAGGGAGCGGACGCGGGTGCACACCATCAGCGCAGCCTTCGAGGCGCTGAGGAAGCA
GGTGCCGTGCTACTCCTATGGGCAGAAGCTCTCCAAACTGGCCATCCTGAGGATTGCCTGTAACTACATC
TTGTCCCTGGCACGGCTGGCTGACCTGGACTACAGTGCCGACCACAGCAACCTCAGCTTCTCCGAGTGTG
TGCAGCGCTGCACCCGCACCCTGCAGGCAGAAGGGCGAGCCAAGAAACGGAAGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204653 protein sequence
Red=Cloning site Green=Tags(s)

MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPVRRANGYKTFRLDLEAPELGATVSTTAATNGLRDRTQ
PFPIATPVPASVAPAVPPGGGTDTAREFRGIRAPEVSDARKRGFALGTVGPGLPTPPPPPASQSLAPGDP
EAHSFREQALRPRILLCAPPARPTQSAPLAPPAAPQESPVRPAPPTRPGESSYSSISHVIYNNHPDSSAS
PRKRPGEATAASTEIKALQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYI
LSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_153778
ORF Size 969 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_153778.3, NP_722473.1
RefSeq Size 2355 bp
RefSeq ORF 969 bp
Locus ID 71093
UniProt ID Q99NA2
MW 34.8 kDa
Gene Summary Transcription factor that binds a palindromic (canonical) core consensus DNA sequence 5'-CANNTG- 3' known as an E-box element, possibly as a heterodimer with other bHLH proteins (By similarity). Regulates endothelial cell proliferation, migration and tube-like structures formation (By similarity). Modulates endothelial cell differentiation through NOS3 (By similarity). May be implicated in specification and differentiation of neuronal cell lineages in the brain (PubMed:11733035). May participate in kidney development and may be involved in podocyte differentiation (PubMed:16937370). During early embryonic development is involved in tissue-specific differentiation processes that are dependent on class II bHLH factors and namely modulates the differentiation program initiated by the pro-endocrine factor NEUROG3 (PubMed:18560595). During myogenesis, may play a role during the transition of myoblasts from the proliferative phase to the differentiation phase (PubMed:24186058). Positively regulates HAMP transcription in two ways, firstly by acting directly on the HAMP promoter via E-boxes binding and indirectly through increased phosphorylation of SMAD protein complex (By similarity). Repress NEUROG3-dependent gene activation in a gene-specific manner through at least two mechanisms; requires only either the sequestering of a general partner such as TCF3 through heterodimerization, either also requires binding of the bHLH domain to DNA via a basic motif (PubMed:23938248).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...