Kcna1 (NM_010595) Mouse Tagged ORF Clone

CAT#: MR222106

  • TrueORF®

Kcna1 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, shaker-related subfamily, member 1 (Kcna1)

ORF Plasmid: DDK tGFP



  "NM_010595" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,330.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit polyclonal Anti-KV1.1
    • 50 ul

CNY 11,000.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AI840627; Kca1-1; Kv1.1; MBK1; mceph; Mk-1; Shak
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR222106 representing NM_010595
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGTGATGTCGGGGGAGAATGCGGACGAGGCTTCGACCGCTCCAGGTCACCCCCAGGATGGCAGCT
ACCCGAGGCAGGCGGACCACGACGACCACGAATGCTGCGAGCGCGTAGTAATCAACATCTCCGGGCTGCG
CTTCGAAACGCAGCTCAAGACTCTGGCACAGTTCCCCAACACGCTGCTGGGCAACCCGAAGAAACGCATG
CGCTACTTTGACCCCCTGAGGAACGAGTACTTCTTTGACCGCAACCGGCCCAGCTTCGATGCCATCCTTT
ATTACTACCAGTCCGGGGGCCGCCTGCGCAGGCCGGTCAACGTGCCCCTGGACATGTTCTCCGAGGAGAT
TAAATTTTACGAGTTGGGCGAGGAAGCCATGGAGAAGTTCCGGGAAGATGAGGGCTTCATCAAGGAAGAG
GAGCGCCCCCTACCCGAGAAGGAGTACCAGCGCCAGGTGTGGCTGCTCTTTGAGTATCCGGAGAGCTCAG
GACCTGCCCGGGTTATTGCCATTGTGTCGGTCATGGTCATCCTCATCTCCATAGTCATCTTTTGCCTGGA
GACTCTCCCTGAGCTGAAGGACGACAAGGACTTCACGGGCACCATCCACCGCATCGACAACACCACAGTC
ATCTATACTTCCAACATCTTCACAGACCCTTTCTTCATTGTGGAAACCTTGTGTATCATCTGGTTCTCTT
TTGAGCTGGTGGTGCGCTTCTTCGCCTGCCCCAGCAAGACAGACTTCTTTAAGAACATCATGAACTTCAT
CGACATTGTGGCCATCATCCCTTATTTCATTACCCTGGGCACGGAGATAGCTGAGCAGGAGGGAAATCAG
AAGGGCGAGCAGGCCACTTCCCTGGCCATCCTCAGGGTCATCCGCTTGGTAAGGGTGTTCAGAATCTTCA
AACTCTCCCGCCACTCCAAGGGCCTTCAGATCCTGGGCCAGACCCTCAAAGCTAGTATGAGGGAGTTAGG
GCTGCTCATCTTTTTCCTCTTCATTGGGGTCATACTGTTTTCTAGCGCAGTGTACTTTGCGGAGGCGGAA
GAAGCTGAGTCGCACTTCTCCAGTATCCCCGATGCTTTCTGGTGGGCGGTGGTGTCCATGACCACTGTGG
GATACGGTGACATGTACCCTGTGACAATTGGAGGCAAGATCGTGGGCTCCTTGTGTGCCATCGCTGGTGT
GCTGACAATTGCCCTGCCCGTACCTGTCATTGTGTCCAATTTCAACTATTTCTACCACCGAGAAACTGAG
GGGGAAGAGCAGGCTCAGTTGCTCCATGTTAGTTCTCCTAACTTAGCCTCTGACAGTGACCTCAGCCGCC
GCAGCTCCTCTACTATCAGCAAGTCTGAGTACATGGAGATCGAAGAGGATATGAACAATAGCATAGCCCA
TTACAGACAGGCTAATATCAGAACTGGTAACTGCACCACAGCTGATCAAAACTGCGTTAATAAGAGCAAG
CTCCTGACCGATGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR222106 representing NM_010595
Red=Cloning site Green=Tags(s)

MTVMSGENADEASTAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRM
RYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEE
ERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFTGTIHRIDNTTV
IYTSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQ
KGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAE
EAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE
GEEQAQLLHVSSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSK
LLTDV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010595
ORF Size 1485 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010595.3, NP_034725.3
RefSeq Size 8970 bp
RefSeq ORF 1488 bp
Locus ID 16485
UniProt ID P16388
MW 56.4 kDa
Gene Summary Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney. Contributes to the regulation of the membrane potential and nerve signaling, and prevents neuronal hyperexcitability (PubMed:9736643, PubMed:9581771 PubMed:10191303, PubMed:12611922, PubMed:21966978, PubMed:22158511, PubMed:23473320). Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane (PubMed:15361858). Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels (PubMed:15361858). In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA1 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure (PubMed:7517498, PubMed:15361858). In contrast, a heterotetrameric channel formed by KCNA1 and KCNA4 shows rapid inactivation (By similarity). Regulates neuronal excitability in hippocampus, especially in mossy fibers and medial perforant path axons, preventing neuronal hyperexcitability (PubMed:23466697). May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons (By similarity). May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA) release (By similarity). Plays a role in regulating the generation of action potentials and preventing hyperexcitability in myelinated axons of the vagus nerve, and thereby contributes to the regulation of heart contraction (PubMed:20392939, PubMed:22641786, PubMed:25377007). Required for normal neuromuscular responses (PubMed:9736643). Regulates the frequency of neuronal action potential firing in response to mechanical stimuli, and plays a role in the perception of pain caused by mechanical stimuli, but does not play a role in the perception of pain due to heat stimuli (PubMed:23473320). Required for normal responses to auditory stimuli and precise location of sound sources, but not for sound perception (PubMed:21966978, PubMed:22396426). The use of toxins that block specific channels suggest that it contributes to the regulation of the axonal release of the neurotransmitter dopamine (PubMed:21233214). Required for normal postnatal brain development and normal proliferation of neuronal precursor cells in the brain (PubMed:8995755, PubMed:17250763, PubMed:17315199, PubMed:22411008). Plays a role in the reabsorption of Mg(2+) in the distal convoluted tubules in the kidney and in magnesium ion homeostasis, probably via its effect on the membrane potential (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...