WIBG (PYM1) (NM_001143853) Human Tagged ORF Clone

CAT#: RG227106

  • TrueORF®

WIBG (tGFP-tagged) - Human within bgcn homolog (Drosophila) (WIBG), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001143853" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


WIBG mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms PYM; WIBG
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG227106 representing NM_001143853
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACTCCCTATGTTACTGACGAGACCGGCGGCAAGTATATCGCGTCAACACAGCGACCTGACGGGA
CCTGGCGCAAGCAGCGGAGGGTGAAAGAAGGATATGTGCCCCAGGAGGAGGTCCCAGTATATGAAAACAA
GTATGTGAAGTTTTTCAAGAGTAAACCAGAGTTGCCCCCAGGGCTAAGCCCTGAGGCCACTGCTCCTGTC
ACCCCATCCAGGCCTGAAGGTGGTGAACCAGGCCTCTCCAAGACAGCCAAACGTAACCTGAAGCGAAAGG
AGAAGAGGCGGCAGCAGCAAGAGAAAGGAGAGGCAGAGGCCTTGAGCAGGACTCTTGATAAGGTGTCCCT
GGAAGAGACAGCCCAACTCCCCAGTGCTCCACAGGGCTCTCGGGCAGCCCCCACAGCTGCATCTGACCAG
CCTGACTCAGCTGCCACCACTGAGAAAGCCAAGAAGATAAAGAACCTAAAGAAGAAACTCCGGCAGGTGG
AAGAGCTGCAGCAGCGGATCCAGGCTGGGGAAGTCAGCCAGCCCAGCAAAGAGCAGCTAGAAAAGCTAGC
AAGGAGGAGGGCGCTAGAAGAGGAGTTAGAGGACTTGGAGTTAGGCCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG227106 representing NM_001143853
Red=Cloning site Green=Tags(s)

MATPYVTDETGGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPV
TPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQ
PDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001143853
ORF Size 609 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001143853.1, NP_001137325.1
RefSeq Size 1105 bp
RefSeq ORF 612 bp
Locus ID 84305
UniProt ID Q9BRP8
Gene Summary Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. May bind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed:14968132, while PubMed:19410547 did not detect RNA-binding activity independently of the EJC.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...