M2 (NC_001781) Virus Tagged ORF Clone
CAT#: VC102103
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for matrix protein 2 [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056865
View other clones from "Virus" (9)
Need custom modification / cloning service?
Get a free quote
CNY 1,320.00
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102103 represents NCBI reference of NP_056865 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAAAACCCAAAATAATGATTCTGCCTGATAAATATCCGTGTTCAATCTCTTCCATTCTGATCAGTT CTGAATCTATGATCGCGACATTTAACCATAAAAACATTCTGCAGTTTAATCACAACCATCTGGACAACCA CCAGCGCCTTCTGAACAACATTTTCGACGAAATTCACTGGACACCCAAGAACCTTCTGGATGCTACCCAA CAGTTCCTGCAGCATCTCAATATACCAGAGGATATCTACACAATATACATTCTGGTCTCA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102103 representing NP_056865
Red=Cloning sites Green=Tags MTKPKIMILPDKYPCSISSILISSESMIATFNHKNILQFNHNHLDNHQRLLNNIFDEIHWTPKNLLDATQ QFLQHLNIPEDIYTIYILVS TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001781 |
ORF Size | 270 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_001781.1, NP_056865 |
RefSeq ORF | 270 bp |
Locus ID | 1489826 |
MW | 10.6 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102094 | Myc-DDK-tagged ORF clone of viral ORF for non-structural protein 1 [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056856 |
CNY 1,800.00 |
|
VC102095 | Myc-DDK-tagged ORF clone of viral ORF for non-structural protein 2 [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056857 |
CNY 1,320.00 |
|
VC102096 | Myc-DDK-tagged ORF clone of viral ORF for N [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056858 |
CNY 5,488.00 |
|
VC102097 | Myc-DDK-tagged ORF clone of viral ORF for P [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056859 |
CNY 3,600.00 |
|
VC102098 | Myc-DDK-tagged ORF clone of viral ORF for M [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056860 |
CNY 3,600.00 |
|
VC102099 | Myc-DDK-tagged ORF clone of viral ORF for SH [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056861 |
CNY 1,320.00 |
|
VC102100 | Myc-DDK-tagged ORF clone of viral ORF for attachment glycoprotein [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056862. Note: ORF is codon optimized |
CNY 2,640.00 |
|
VC102101 | Myc-DDK-tagged ORF clone of viral ORF for fusion protein [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056863 |
CNY 6,408.00 |
|
VC102102 | Myc-DDK-tagged ORF clone of viral ORF for matrix protein 2 [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056864 |
CNY 2,640.00 |