MYL9 (NM_181526) Human Mass Spec Standard
CAT#: PH301080
MYL9 MS Standard C13 and N15-labeled recombinant protein (NP_852667)
View other "MYL9" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MYL9 MS Standard C13 and N15-labeled recombinant protein (NP_852667) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201080 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC201080 protein sequence
Red=Cloning site Green=Tags(s) MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLR ELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_852667 |
RefSeq Size | 1054 |
RefSeq ORF | 354 |
Synonyms | LC20; MLC-2C; MLC2; MMIHS4; MRLC1; MYRL2 |
Locus ID | 10398 |
Cytogenetics | 20q11.23 |
Summary | Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405690 | MYL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416863 | MYL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405690 | Transient overexpression lysate of myosin, light chain 9, regulatory (MYL9), transcript variant 2 |
CNY 3,080.00 |
|
LY416863 | Transient overexpression lysate of myosin, light chain 9, regulatory (MYL9), transcript variant 1 |
CNY 3,080.00 |
|
TP301080 | Recombinant protein of human myosin, light chain 9, regulatory (MYL9), transcript variant 2, 20 µg |
CNY 2,900.00 |