MYL9 (NM_181526) Human Recombinant Protein
CAT#: TP301080
Recombinant protein of human myosin, light chain 9, regulatory (MYL9), transcript variant 2, 20 µg
View other "MYL9" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201080 protein sequence
Red=Cloning site Green=Tags(s) MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLR ELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_852667 |
Locus ID | 10398 |
UniProt ID | P24844 |
Refseq Size | 1054 |
Cytogenetics | 20q11.23 |
Refseq ORF | 354 |
Synonyms | LC20; MLC-2C; MLC2; MMIHS4; MRLC1; MYRL2 |
Summary | Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405690 | MYL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416863 | MYL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405690 | Transient overexpression lysate of myosin, light chain 9, regulatory (MYL9), transcript variant 2 |
CNY 3,080.00 |
|
LY416863 | Transient overexpression lysate of myosin, light chain 9, regulatory (MYL9), transcript variant 1 |
CNY 3,080.00 |
|
PH301080 | MYL9 MS Standard C13 and N15-labeled recombinant protein (NP_852667) |
CNY 19,520.00 |