NUDT6 (NM_007083) Human Mass Spec Standard
CAT#: PH303470
NUDT6 MS Standard C13 and N15-labeled recombinant protein (NP_009014)
View other "NUDT6" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | NUDT6 MS Standard C13 and N15-labeled recombinant protein (NP_009014) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203470 |
Predicted MW | 35.7 kDa |
Protein Sequence |
>RC203470 protein sequence
Red=Cloning site Green=Tags(s) MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLD AAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYA SHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQ QHTNPGAFGKSDMYIICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFD KIDLTVEELPAVYTGLFYKLYHKELPENYKTMKGID myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009014 |
RefSeq Size | 1197 |
RefSeq ORF | 948 |
Synonyms | ASFGF2; FGF-AS; FGF2AS; GFG-1; GFG1 |
Locus ID | 11162 |
Cytogenetics | 4q28.1 |
Summary | This gene overlaps and lies on the opposite strand from FGF2 gene, and is thought to be the FGF2 antisense gene. The two genes are independently transcribed, and their expression shows an inverse relationship, suggesting that this antisense transcript may regulate FGF2 expression. This gene has also been shown to have hormone-regulatory and antiproliferative actions in the pituitary that are independent of FGF2 expression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402086 | NUDT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405102 | NUDT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402086 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1 |
CNY 3,080.00 |
|
LY405102 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 2 |
CNY 3,080.00 |
|
TP303470 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760249 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |