NUDT6 (NM_007083) Human Recombinant Protein
CAT#: TP303470
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1, 20 µg
View other "NUDT6" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203470 protein sequence
Red=Cloning site Green=Tags(s) MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLD AAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYA SHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQ QHTNPGAFGKSDMYIICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFD KIDLTVEELPAVYTGLFYKLYHKELPENYKTMKGID myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009014 |
Locus ID | 11162 |
UniProt ID | P53370 |
Refseq Size | 1197 |
Cytogenetics | 4q28.1 |
Refseq ORF | 948 |
Synonyms | ASFGF2; FGF-AS; FGF2AS; GFG-1; GFG1 |
Summary | This gene overlaps and lies on the opposite strand from FGF2 gene, and is thought to be the FGF2 antisense gene. The two genes are independently transcribed, and their expression shows an inverse relationship, suggesting that this antisense transcript may regulate FGF2 expression. This gene has also been shown to have hormone-regulatory and antiproliferative actions in the pituitary that are independent of FGF2 expression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402086 | NUDT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405102 | NUDT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402086 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1 |
CNY 3,080.00 |
|
LY405102 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 2 |
CNY 3,080.00 |
|
PH303470 | NUDT6 MS Standard C13 and N15-labeled recombinant protein (NP_009014) |
CNY 19,520.00 |
|
TP760249 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |