NORE1 (RASSF5) (NM_182665) Human Mass Spec Standard
CAT#: PH303854
RASSF5 MS Standard C13 and N15-labeled recombinant protein (NP_872606)
View other "NORE1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | RASSF5 MS Standard C13 and N15-labeled recombinant protein (NP_872606) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203854 |
Predicted MW | 30.4 kDa |
Protein Sequence |
>RC203854 protein sequence
Red=Cloning site Green=Tags(s) MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREK NCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHIS STTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENE TGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_872606 |
RefSeq Size | 3531 |
RefSeq ORF | 795 |
Synonyms | Maxp1; NORE1; NORE1A; NORE1B; RAPL; RASSF3 |
Locus ID | 83593 |
Cytogenetics | 1q32.1 |
Summary | This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras, Rap1, and several other Ras-like small GTPases. The protein regulates lymphocyte adhesion and suppresses cell growth in response to activated Rap1 or Ras. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Leukocyte transendothelial migration, Non-small cell lung cancer, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405439 | RASSF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405440 | RASSF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405439 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2 |
CNY 3,080.00 |
|
LY405440 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3 |
CNY 3,080.00 |
|
TP303854 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 20 µg |
CNY 2,900.00 |