TEM8 (ANTXR1) (NM_018153) Human Mass Spec Standard
CAT#: PH304112
ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_060623)
View other "TEM8" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_060623) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204112 |
Predicted MW | 37.1 kDa |
Protein Sequence |
>RC204112 protein sequence
Red=Cloning site Green=Tags(s) MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLA HKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYR TASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQG IIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLL CPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSLHKIASGPTTAACME myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060623 |
RefSeq Size | 2360 |
RefSeq ORF | 999 |
Synonyms | ATR; GAPO; TEM8 |
Locus ID | 84168 |
Cytogenetics | 2p13.3 |
Summary | This gene encodes a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. The encoded protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409333 | ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413252 | ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409333 | Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 2 |
CNY 3,080.00 |
|
LY413252 | Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 3 |
CNY 3,080.00 |
|
PH318473 | ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_444262) |
CNY 19,520.00 |
|
TP304112 | Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP318473 | Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 2, 20 µg |
CNY 2,900.00 |