TEM8 (ANTXR1) (NM_018153) Human Recombinant Protein
CAT#: TP304112
Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, 20 µg
View other "TEM8" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204112 protein sequence
Red=Cloning site Green=Tags(s) MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLA HKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYR TASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQG IIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLL CPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSLHKIASGPTTAACME myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060623 |
Locus ID | 84168 |
UniProt ID | Q9H6X2, Q96EC6 |
Refseq Size | 2360 |
Cytogenetics | 2p13.3 |
Refseq ORF | 999 |
Synonyms | ATR; GAPO; TEM8 |
Summary | This gene encodes a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. The encoded protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409333 | ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413252 | ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409333 | Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 2 |
CNY 3,080.00 |
|
LY413252 | Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 3 |
CNY 3,080.00 |
|
PH304112 | ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_060623) |
CNY 19,520.00 |
|
PH318473 | ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_444262) |
CNY 19,520.00 |
|
TP318473 | Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 2, 20 µg |
CNY 2,900.00 |