Apc6 (CDC16) (NM_003903) Human Mass Spec Standard
CAT#: PH305639
CDC16 MS Standard C13 and N15-labeled recombinant protein (NP_003894)
View other "Apc6" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CDC16 MS Standard C13 and N15-labeled recombinant protein (NP_003894) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205639 |
Predicted MW | 71.5 kDa |
Protein Sequence |
>RC205639 representing NM_003903
Red=Cloning site Green=Tags(s) MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYE ACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIY DALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLK KYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNK ANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEH DQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHS LMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003894 |
RefSeq Size | 2235 |
RefSeq ORF | 1860 |
Synonyms | ANAPC6; APC6; CDC16Hs; CUT9 |
Locus ID | 8881 |
Cytogenetics | 13q34 |
Summary | The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418359 | CDC16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421501 | CDC16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY418359 | Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1 |
CNY 3,080.00 |
|
LY421501 | Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2 |
CNY 4,840.00 |
|
PH324869 | CDC16 MS Standard C13 and N15-labeled recombinant protein (NP_001072113) |
CNY 19,520.00 |
|
TP305639 | Recombinant protein of human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP324869 | Recombinant protein of human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, 20 µg |
CNY 2,900.00 |